Cambio - Excellence in Molecular Biology

Membrane protein work

Membrane protein work: Nanodisc Active GPCR

Nanodiscs provide an exciting alternative for the stabilization of membrane proteins. Cube Biotech offers everything you need to get started with this novel technology. There are two options to reconstitute membrane proteins into nanodiscs:

GLP1R protein

GLP1R protein

Cambio

Description

Active, purified GLP1R (Glucagon-like peptide 1 receptor)

Membrane proteins are the most pharmaceutically relevant protein class. At the same time, it is very difficult to obtain them in pure, active form. Cube Biotech's protein experts have worked hard to produce human GPCRs in sufficient quality that we can now offer to the community.

We offer active, purified GLP1R,  a human GPCR involved in insuline production and appetite regulation.

The protein is available off-the shelf, ready for ligand binding studies, crystallization, and other biochemical/biophysical experiments.

 

Protein

GLP1R (Glucagon-like peptide 1 receptor)

Alternative names

GLP1-receptor

UniProt number

P43220

Protein class

GPCR, class B

Organism

Human (Homo sapiens)

Sequence

Full-length, wildtype sequence
N-terminal HA tag (underlined), initial methionine in bold, C-terminal 10x His-tag in red,
HRV 3C protease site in blue, spacer in bold grey, Rho1D4 tag in bold green
 
MKTIIALSYIFCLVFARPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCP
WYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAIL
LGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLV
EGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVI
CIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQL
EFRKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCSGGHHHHHHHHHHLEVLFQGPGSSG
TETSQVAPA

Affinity tags

His / Rho1D4 (both C-terminal)
Size (excluding
additional elements)
489 (463) amino acids
56,170 (53,026) Da

Expression system

Sf9 (baculovirus)

Purified via

Protein-specific affinity matrix using immobilized agonist ligand

Buffer

20 mM HEPES pH 7.5, 150 mM NaCl, 10% Glycerol, 0.02% Foscholine-12

Purity (SDS-PAGE)

>98% as determined by SDS-PAGE

Homogeneity

Size exclusion chromatography

Activity

Ligand binding measured by SPR using the agonist ligand exendin-4 at 10°C. Using a 1:1 binding model, the kD was determined to be 6.11 x 10e7 M, which is in accordance with published values.

Function

Receptor for glucagon-like peptide 1. Expressed in pancreas, brain, heart, kidney and the GI tract. Involved in insuline secretion and appetite regulation.
Literature  references:
1. Hwang JI et al. Molecular evolution of GPCRs: GLP1/GLP1 receptors. J. Mol. Endocrinol. (2014) 52 (3) 15-27.
2. Sisley S. et al. Neuronal GLP1R mediates liraglutide's anorectic but not glucose-lowering effect. (2014) J. Clin. inv. 124(6)2456-2463.

If you cannot find the answer to your problem then please contact us or telephone +44 (0)1954 210 200

Related products

If you cannot find the answer to your problem then please contact us or telephone +44 (0)1954 210 200